Rabbit Anti-ASCIZ Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-3207P

• Product Name:
• Rabbit Anti-ASCIZ Polyclonal Antibody

• Formulation:
• Lyophilised:200 µl Steriled Distilled Water

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fragment corresponding to Human ASCIZ aa 595-768. This sequence corresponds to aa 650-823 of reviewed Uniprot entry O43313. Sequence: QTEESELSTMTTEPVLESLDIETQTDFLLADTSAQSYGCRGNSNFLGLEM FDTQTQTDLNFFLDSSPHLPLGSILKHSSFSVSTDSSDTETQTEGVSTAK NIPALES

• Species Reactivity:
• Human Predicted to work with: Mouse

• Isotype:
• IgG

• Application:
• WB, IHC-P

• Storage Buffer:
• pH: 7.2 Preservative: 0.02% Sodium azide Constituents: 98% PBS, 1% BSA

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal