Cat#:FPA-3094P;Product Name:Rabbit Anti-Arrestin C Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide within Human Arrestin C aa 339-388 (C terminal). The exact sequence is proprietary. NP_004303.2. Sequence: DVGVELPLVLIHPKPSHEAASSEDIVIEEFTRKGEEESQKAVEAEGDEGS ;Species Reactivity:Human;Isotype:IgG;Application:WB, IHC-P;Storage Buffer:pH: 7.40 Preservative: 0.02% Sodium azide Constituents: 49% PBS, 0.87% Sodium chloride, 50% Glycerol PBS (without Mg2+, Ca2+);Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;
Rabbit Anti-Arrestin C Polyclonal Antibody
Online Inquiry
Cat#:
FPA-3094P
Product Name:
Rabbit Anti-Arrestin C Polyclonal Antibody
Host Species:
Rabbit
Immunogen:
Synthetic peptide within Human Arrestin C aa 339-388 (C terminal). The exact sequence is proprietary. NP_004303.2. Sequence: DVGVELPLVLIHPKPSHEAASSEDIVIEEFTRKGEEESQKAVEAEGDEGS