Rabbit Anti-ARMC3 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-3004P

• Product Name:
• Rabbit Anti-ARMC3 Polyclonal Antibody

• Formulation:
• Liquid

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human ARMC3 aa 760-805 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary. Sequence: PKEKLPDFSWELHISELKFQLKSNVIPIGHVKKGIFYHRALLFKAL

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat

• Isotype:
• IgG

• Application:
• ICC/IF

• Storage Buffer:
• Preservative: 0.09% Sodium azide Constituents: 50% Glycerol, 1% BSA

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.