Cat#:FPA-2991P;Product Name:Rabbit Anti-ARL6IP4 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide within Human ARL6IP4 aa 310-360. The exact sequence is proprietary. Sequence: VVDPETGRTRLIKGDGEVLEEIVTKERHREINKQATRGDCLAFQMRAGLL P ;Species Reactivity:Human Predicted to work with: Rat, Sheep, Cow, Cat, Dog, Pig, Chimpanzee, Rhesus monkey, Orangutan;Isotype:IgG;Application:IP;Storage Buffer:Preservative: 0.09% Sodium azide Constituent: 99% Tris citrate/phosphate pH 7 to 8;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;