Rabbit Anti-ARL6IP4 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-2991P

• Product Name:
• Rabbit Anti-ARL6IP4 Polyclonal Antibody

• Formulation:
• Liquid

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human ARL6IP4 aa 310-360. The exact sequence is proprietary. Sequence: VVDPETGRTRLIKGDGEVLEEIVTKERHREINKQATRGDCLAFQMRAGLL P

• Species Reactivity:
• Human Predicted to work with: Rat, Sheep, Cow, Cat, Dog, Pig, Chimpanzee, Rhesus monkey, Orangutan

• Isotype:
• IgG

• Application:
• IP

• Storage Buffer:
• Preservative: 0.09% Sodium azide Constituent: 99% Tris citrate/phosphate pH 7 to 8

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.