Rabbit Anti-ARL17B Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-2973P

• Product Name:
• Rabbit Anti-ARL17B Polyclonal Antibody

• Formulation:
• Liquid

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to a region within the internal sequence aa 108-157 (CSHVEFGMWKGGRSHPFLPHSSRCAGSGGQLDSILPHQSPAWGPWGCKD L) of Human ARL17B (NP_001034172).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.