Cat#:FPA-2717P;Product Name:Rabbit Anti-APXL Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide corresponding to a region within the internal sequence aa 1296-1345 of Human APXL ( TSPPGLSYMKAKEKTVEDLKSEELAREIVGKDKSLADILDPSVKIKTTMD ); NP_001640 ;Species Reactivity:Human Predicted to work with: Mouse, Rat, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish;Isotype:IgG;Application:WB;Storage Buffer:Preservative: None Constituents: 2% Sucrose, PBS;Storage Procedures:Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.;
Synthetic peptide corresponding to a region within the internal sequence aa 1296-1345 of Human APXL ( TSPPGLSYMKAKEKTVEDLKSEELAREIVGKDKSLADILDPSVKIKTTMD ); NP_001640
Species Reactivity:
Human Predicted to work with: Mouse, Rat, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish
Isotype:
IgG
Application:
WB
Storage Buffer:
Preservative: None Constituents: 2% Sucrose, PBS
Storage Procedures:
Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.