Rabbit Anti-Apolipoprotein CI Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-2609P

• Product Name:
• Rabbit Anti-Apolipoprotein CI Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Recombinant full length protein corresponding to Human Apolipoprotein CI aa 1-83. Sequence: MRLFLSLPVLVVVLSIVLEGPAPAQGTPDVSSALDKLKEFGNTLEDKARE LISRIKQSELSAKMREWFSETFQKVKEKLKIDS

• Species Reactivity:
• Human Predicted to work with: Chimpanzee

• Isotype:
• IgG

• Application:
• WB, IHC-P

• Storage Buffer:
• pH: 7.3 Preservative: 0.02% Sodium azide Constituents: 50% Glycerol, 49% PBS

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid