Rabbit Anti-APOBEC3B Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-2531P

• Product Name:
• Rabbit Anti-APOBEC3B Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to a region within N-terminal aa 78-127 ( NQLPAYKCFQITWFVSWTPCPDCVAKLAEFLSEHPNVTLTISAARLYYYW ) of human APOBEC3B (NP_004891).

• Species Reactivity:
• Human Predicted to work with: Rat, Horse, Pig, Zebrafish

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.

• Clonality:
• Polyclonal

• Form:
• Liquid