Cat#:FPA-2240P;Product Name:Rabbit Anti-Ankyrin repeat domain-containing protein 65 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Recombinant fragment corresponding to Human Ankyrin repeat domain-containing protein 65 aa 13-64. Sequence: EEEQELRWMELDSEEALGTRTEGPSVVQGWGHLLQAVWRGPAGLVTQLLR QGH ;Species Reactivity:Human;Isotype:IgG;Application:WB, IHC-P;Storage Buffer:pH: 7.2 Preservative: 0.02% Sodium azide Constituents: 59% PBS, 40% Glycerol;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;
Rabbit Anti-Ankyrin repeat domain-containing protein 65 Polyclonal Antibody
Online Inquiry
Cat#:
FPA-2240P
Product Name:
Rabbit Anti-Ankyrin repeat domain-containing protein 65 Polyclonal Antibody
Host Species:
Rabbit
Immunogen:
Recombinant fragment corresponding to Human Ankyrin repeat domain-containing protein 65 aa 13-64. Sequence: EEEQELRWMELDSEEALGTRTEGPSVVQGWGHLLQAVWRGPAGLVTQLLR QGH