Rabbit Anti-ANKRD7 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-2221P

• Product Name:
• Rabbit Anti-ANKRD7 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide, corresponding to an internal region within aa 109-158 (ILLNFGADPDLRDIRYNTVLHYAVCGQSLSLVEKLLEYEADLEAKNKDG Y) of Human ANKRD7, NP_001071176

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid