Rabbit Anti-ANKLE2 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-2141P

• Product Name:
• Rabbit Anti-ANKLE2 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to a region within the middle aa 864-913 ( CYSPSDRQSWPSPAVKGRFKSQLPDLSGPHSYSPGRNSVAGSNPAKPGLG ) of Human ANKLE2 (NP_055929)

• Species Reactivity:
• Human Predicted to work with: Cat

• Isotype:
• IgG

• Application:
• ELISA, WB

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid