Rabbit Anti-AL2S7 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-45929P

• Product Name:
• Rabbit Anti-AL2S7 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Mouse AL2S7 aa 51-100 (N terminal). The exact sequence is proprietary. NP_001028545 Sequence: ASFHPRGLEAASAQKLKSKRPRSNSDSFQEENLRQGLPWKKSLPFGAASS Database link: Q3V3A1 Run BLAST with Run BLAST with

• Species Reactivity:
• Mouse Predicted to work with: Rat, Rabbit, Horse, Cat, Dog, Human, Pig

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Immunogen affinity purified

• Clonality:
• Polyclonal

• Form:
• Liquid