Cat#:FPA-1179P;Product Name:Rabbit Anti-AHI1 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide within Human AHI1 aa 1-42 (N terminal). The exact sequence is proprietary. NP_060121.3. Sequence: MPTAESEAKVKTKVRFEELLKTHSDLMREKKKLKKKLVRSEE ;Species Reactivity:Human;Isotype:IgG;Application:WB, IHC-P;Storage Buffer:pH: 7.00 Preservative: 0.01% Thimerosal (merthiolate) Constituents: 10% Glycerol, 89% Tris glycine;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;
Synthetic peptide within Human AHI1 aa 1-42 (N terminal). The exact sequence is proprietary. NP_060121.3. Sequence: MPTAESEAKVKTKVRFEELLKTHSDLMREKKKLKKKLVRSEE