Rabbit Anti-ADPRH Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-45914P

• Product Name:
• Rabbit Anti-ADPRH Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fragment corresponding to Human ADPRH aa 19-90. Sequence: YYNGKWEFLQDGEKIHRQLAQLGGLDALDVGRWRVSDDTVMHLATAEALV EAGKAPKLTQLYYLLAKHYQDC Database link: P54922 Run BLAST with Run BLAST with

• Species Reactivity:
• Human Predicted to work with: Cow

• Isotype:
• IgG

• Application:
• ICC/IF

• Storage Buffer:
• Immunogen affinity purified

• Storage Procedures:
• pH: 7.2 Constituents: 40% Glycerol, 59% PBS

• Clonality:
• Polyclonal

• Form:
• Liquid