• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-Adiponectin Receptor 2 Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-1011P
  • Product Name:
  • Rabbit Anti-Adiponectin Receptor 2 Polyclonal Antibody
  • Formulation:
  • Liquid
  • Host Species:
  • Rabbit
  • Immunogen:
  • Synthetic peptide corresponding to Human Adiponectin Receptor 2 aa 50-80 (internal sequence) conjugated to Keyhole Limpet Haemocyanin (KLH). NP_078827.2. Sequence: VLSSHHKKSSEEHEYSDEAPQEDEGFMGMSP
  • Species Reactivity:
  • Human
  • Isotype:
  • IgG
  • Application:
  • WB, IHC-P, Flow Cyt, ICC/IF
  • Storage Buffer:
  • Preservative: 0.09% Sodium azide Constituent: 99% PBS
  • Storage Procedures:
  • Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.
  • Pre product:Rabbit Anti-Adiponectin Receptor 1 Polyclonal Antibody-Advanced Biomart
  • Online Inquiry

    refresh