Rabbit Anti-ADAD2 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-769P

• Product Name:
• Rabbit Anti-ADAD2 Polyclonal Antibody

• Formulation:
• Liquid

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to a region within aa 359-408 ( GQQLHDCHGLVIARRALLRFLFRQLLLATQGGPKGKEQSVLAPQPGPGPP ) of Human ADAD2 (NP_631913).

• Species Reactivity:
• Human Predicted to work with: Rat, Rabbit, Horse, Cow, Cat, Pig

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.