Cat#:FPA-651P;Product Name:Rabbit Anti-ACTH Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide corresponding to ACTH aa 138-176. Sequence: SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF ;Species Reactivity:Mouse, Rat, Human Predicted to work with: Sheep, Goat, Chicken, Guinea pig, Cow, Dog, Chimpanzee, Macaque monkey, Orangutan;Isotype:IgG;Application:IHC-P, IHC-Fr, WB, IP;Storage Buffer:Preservative: 0.02% Sodium Azide;Storage Procedures:Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.;