• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-ACTH Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-651P
  • Product Name:
  • Rabbit Anti-ACTH Polyclonal Antibody
  • Host Species:
  • Rabbit
  • Immunogen:
  • Synthetic peptide corresponding to ACTH aa 138-176. Sequence: SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
  • Species Reactivity:
  • Mouse, Rat, Human Predicted to work with: Sheep, Goat, Chicken, Guinea pig, Cow, Dog, Chimpanzee, Macaque monkey, Orangutan
  • Isotype:
  • IgG
  • Application:
  • IHC-P, IHC-Fr, WB, IP
  • Storage Buffer:
  • Preservative: 0.02% Sodium Azide
  • Storage Procedures:
  • Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Clonality:
  • Polyclonal
  • Form:
  • Liquid
  • Pre product:Rabbit Anti-ACTG2 Polyclonal Antibody-FPA-650P
  • Online Inquiry

    refresh