Rabbit Anti-ACSS1 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-638P

• Product Name:
• Rabbit Anti-ACSS1 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human ACSS1 aa 125-174 (internal sequence). The exact sequence is proprietary. Isoform 3 Sequence: QHVLVAHRTDNKVHMGDLDVPLEQEMAKEDPVCAPESMGSEDMLFMLYTS

• Species Reactivity:
• Human Predicted to work with: Mouse, Sheep, Rabbit, Horse, Cow, Cat, Dog, Pig

• Isotype:
• IgG

• Application:
• WB

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid