Rabbit Anti-Aconitase 2 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-566P

• Product Name:
• Rabbit Anti-Aconitase 2 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to a region within internal sequence aa 648-697 ( RYYKKHGIRWVVIGDENYGEGSSREHAALEPRHLGGRAIITKSFARIHET ) of human ACO2 (NP_001089).

• Species Reactivity:
• Mouse, Human, Caenorhabditis elegans Predicted to work with: Rat, Chicken, Cow, Dog, Pig, Saccharomyces cerevisiae, Drosophila melanogaster, Zebrafish

• Isotype:
• IgG

• Application:
• ICC/IF, ELISA, IHC-P, WB

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid