• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-Acidic Calponin Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-544P
  • Product Name:
  • Rabbit Anti-Acidic Calponin Polyclonal Antibody
  • Host Species:
  • Rabbit
  • Immunogen:
  • Recombinant fragment corresponding to Human Acidic Calponin aa 270-329 (C terminal). Sequence: PKYCAAPTEPVIHNGSQGTGTNGSEISDSDYQAEYPDEYHGEYQDDYPRD YQYSDQGIDY
  • Species Reactivity:
  • Human Predicted to work with: Mouse, Rat, Cow
  • Isotype:
  • IgG
  • Application:
  • ICC/IF, IHC-P, WB
  • Storage Buffer:
  • pH: 7.2 Preservative: 0.02% Sodium azide Constituents: 59% PBS, 40% Glycerol
  • Storage Procedures:
  • Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.
  • Clonality:
  • Polyclonal
  • Form:
  • Liquid
  • Pre product:Rabbit Anti-Acidic Calponin Polyclonal Antibody-FPA-543P
  • Online Inquiry

    refresh