Cat#:FPA-544P;Product Name:Rabbit Anti-Acidic Calponin Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Recombinant fragment corresponding to Human Acidic Calponin aa 270-329 (C terminal). Sequence: PKYCAAPTEPVIHNGSQGTGTNGSEISDSDYQAEYPDEYHGEYQDDYPRD YQYSDQGIDY ;Species Reactivity:Human Predicted to work with: Mouse, Rat, Cow;Isotype:IgG;Application:ICC/IF, IHC-P, WB;Storage Buffer:pH: 7.2 Preservative: 0.02% Sodium azide Constituents: 59% PBS, 40% Glycerol;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;
Recombinant fragment corresponding to Human Acidic Calponin aa 270-329 (C terminal). Sequence: PKYCAAPTEPVIHNGSQGTGTNGSEISDSDYQAEYPDEYHGEYQDDYPRD YQYSDQGIDY