Product finder
Cat#:FPA-486P;Product Name:Rabbit Anti-ACBD3 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide corresponding to Rat ACBD3 aa 228-277 (internal sequence). Sequence: RIEEERLRLEQQKQQIMAALNSQTAVQFQQYAAQQYPGNYEQQQILIRQL ;Species Reactivity:Rat Predicted to work with: Mouse, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Human, Zebrafish;Isotype:IgG;Application:WB;Storage Buffer:Constituents: 98% PBS, 2% Sucrose;Storage Procedures:Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.;
Rabbit Anti-ACBD3 Polyclonal Antibody
Online Inquiry
- Product Name:
- Rabbit Anti-ACBD3 Polyclonal Antibody
- Immunogen:
- Synthetic peptide corresponding to Rat ACBD3 aa 228-277 (internal sequence). Sequence: RIEEERLRLEQQKQQIMAALNSQTAVQFQQYAAQQYPGNYEQQQILIRQL
- Species Reactivity:
- Rat Predicted to work with: Mouse, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Human, Zebrafish
- Storage Buffer:
- Constituents: 98% PBS, 2% Sucrose
- Storage Procedures:
- Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
Pre product:Rabbit Anti-ACAT2 Polyclonal Antibody-FPA-485P
Next product:Rabbit Anti-ACBD4 Polyclonal Antibody-FPA-487P