Rabbit Anti-AAMDC Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-260P

• Product Name:
• Rabbit Anti-AAMDC Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to Rat AAMDC aa 8-57 (N terminal). Synthetic peptide corresponding to a region within N-terminal aa 8-57 of Rat RGD1561459 (NM_001108493). Sequence: IASLSWGQMKVQGSTLTYKDCKVWPGGSRAWDWRETGTEHSPGVQPADVK

• Species Reactivity:
• Rat Predicted to work with: Mouse, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Human, Zebrafish

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Constituents: 97% PBS, 2% Sucrose

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.

• Clonality:
• Polyclonal

• Form:
• Liquid