Cat#:FPA-029P;Product Name:Rabbit Anti-14-3-3 epsilon Polyclonal Antibody;Formulation:Liquid;Host Species:Rabbit ;Immunogen:Recombinant full length protein corresponding to Human 14-3-3 epsilon aa 2-254. (With tag; BC000179). Sequence: DDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKN VIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDIL DVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRK;Species Reactivity:Mouse, Rat, Human Predicted to work with: Sheep, Chicken, Cow;Isotype:IgG;Application:WB, IHC-P;Storage Buffer:pH: 7.30 Preservative: 0.05% Sodium azide Constituents: 49% PBS, 50% Glycerol Note: PBS without Mg2+ and Ca2+.;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;