Cat#:FPA-22115M;Product Name:Mouse Anti-ZNF703 Monoclonal Antibody;Formulation:Liquid;Host Species:Mouse ;Immunogen:Recombinant fragment corresponding to Human ZNF703 AA 156-216. Sequence: PYSKGSGGGDSRKDSGSSSVSSTSSSSSSSPGDKAGFRVPSAACPPFPPH GAPVSASSSSS ;Species Reactivity:Human Predicted to work with: Mouse, Rat;Clone#:BK9543;Isotype:IgG1;Application:WB, IHC-P;Positive control:Human breast carcinoma, colorectal adenocarcinoma, stomach, small intestine, rectum, placenta and liver tissues.;Storage Buffer:pH: 7.2 Preservative: 0.02% Sodium azide Constituents: 40% Glycerol, 59% PBS;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.;