• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Mouse Anti-ZNF703 Monoclonal Antibody Online Inquiry

  • Cat#:
  • FPA-22115M
  • Product Name:
  • Mouse Anti-ZNF703 Monoclonal Antibody
  • Formulation:
  • Liquid
  • Host Species:
  • Mouse
  • Immunogen:
  • Recombinant fragment corresponding to Human ZNF703 AA 156-216. Sequence: PYSKGSGGGDSRKDSGSSSVSSTSSSSSSSPGDKAGFRVPSAACPPFPPH GAPVSASSSSS
  • Species Reactivity:
  • Human Predicted to work with: Mouse, Rat
  • Clone#:
  • BK9543
  • Isotype:
  • IgG1
  • Application:
  • WB, IHC-P
  • Positive control:
  • Human breast carcinoma, colorectal adenocarcinoma, stomach, small intestine, rectum, placenta and liver tissues.
  • Storage Buffer:
  • pH: 7.2 Preservative: 0.02% Sodium azide Constituents: 40% Glycerol, 59% PBS
  • Storage Procedures:
  • Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Pre product:Rabbit Anti-ZNF699 Monoclonal Antibody-Advanced Biomart
  • Online Inquiry

    refresh