Mouse Anti-YKT6 Monoclonal Antibody Online Inquiry

• Cat#:
• FPA-22016M

• Product Name:
• Mouse Anti-YKT6 Monoclonal Antibody

• Formulation:
• Liquid

• Host Species:
• Mouse

• Immunogen:
• Recombinant fragment (proprietary-tag) corresponding to Human YKT6 AA 99-198. Sequence: DEFSKQVDRIDWPVGSPATIHYPALDGHLSRYQNP

• Species Reactivity:
• Recombinant fragment Predicted to work with: Mouse, Rat, Horse, Chicken, Cow, Dog, Human, Chimpanzee, Rhesus monkey

• Clone#:
• 27EF662

• Isotype:
• IgG1

• Application:
• WB, ELISA

• Storage Buffer:
• Preservative: None Constituents: 1X PBS, pH 7.2

• Storage Procedures:
• Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.