Cat#:FPA-21883M;Product Name:Mouse Anti-WASP Monoclonal Antibody;Formulation:Liquid;Host Species:Mouse ;Immunogen:Recombinant fragment corresponding to Human WASP AA 57-170. Expressed in E. Coli. Sequence: LPPGAEHWTKEHCGAVCFVKDNPQKSYFIRLYGLQAGRLLWEQELYSQLV YSTPTPFFHTFAGDDCQAGLNFADEDEAQAFRALVQEKIQKRNQRQSGDR RQLPPPPTPANEER ;Species Reactivity:Human Predicted to work with: Mouse;Clone#:6A19D3;Isotype:IgG2a;Application:WB, IHC-P, Flow Cyt;Positive control:Human WASP (aa: 57-170) recombinant protein; Human WASP (aa: 57-170)-hIgGFc transfected HEK293 cell lysate; HeLa cells; Human ovarian cancer and colon cancer tissues;Storage Buffer:Preservative: 0.05% Sodium azide Constituent: 99% PBS;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.;