Mouse Anti-Tryptophan 5 hydroxylase 2 Monoclonal Antibody Online Inquiry

• Cat#:
• FPA-21093M

• Product Name:
• Mouse Anti-Tryptophan 5 hydroxylase 2 Monoclonal Antibody

• Host Species:
• Mouse

• Immunogen:
• Recombinant fragment corresponding to Human Tryptophan 5 hydroxylase 2 AA 438-489 (C terminal). Sequence: SITRPFSVYFNPYTQSIEILKDTRSIENVVQDLRSDLNTVCDALNKMNQY LG

• Species Reactivity:
• Mouse, Rat, Human Predicted to work with: Horse, Rhesus monkey

• Clone#:
• BK1889

• Isotype:
• IgG1

• Application:
• IHC-P

• Positive control:
• Human dorsal raphe and cerebral cortex tissue; rat dorsal raphe and cerebral cortex tissue: mouse basal forebrain and cerebral cortex tissue.

• Storage Buffer:
• pH: 7.2 Preservative: 0.02% Sodium azide Constituents: 40% Glycerol, 59% PBS

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

• Clonality:
• Monoclonal

• Form:
• Liquid