• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Mouse Anti-TMEM16A Monoclonal Antibody Online Inquiry

  • Cat#:
  • FPA-20631M
  • Product Name:
  • Mouse Anti-TMEM16A Monoclonal Antibody
  • Host Species:
  • Mouse
  • Immunogen:
  • Synthetic peptide corresponding to Human TMEM16A AA 904-986. Conjugated to a carrier protein. Sequence: MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLLETCMEKER QKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL
  • Species Reactivity:
  • Human
  • Clone#:
  • CNF-1.1
  • Isotype:
  • IgG1
  • Application:
  • ICC/IF, Flow Cyt, IHC-P
  • Positive control:
  • Gastrointestinal stromal tumor (GIST) and testicular germ cell tumor tissues. Melanocytes in the basal layer of the epidermis and mast cells in the dermis of normal skin.
  • Storage Procedures:
  • Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Clonality:
  • Monoclonal
  • Form:
  • Liquid
  • Pre product:Mouse Anti-TMEM16A Monoclonal Antibody-FPA-20630M
  • Online Inquiry

    refresh