Mouse Anti-TMEM16A Monoclonal Antibody Online Inquiry

• Cat#:
• FPA-20631M

• Product Name:
• Mouse Anti-TMEM16A Monoclonal Antibody

• Host Species:
• Mouse

• Immunogen:
• Synthetic peptide corresponding to Human TMEM16A AA 904-986. Conjugated to a carrier protein. Sequence: MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLLETCMEKER QKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL

• Species Reactivity:
• Human

• Clone#:
• CNF-1.1

• Isotype:
• IgG1

• Application:
• ICC/IF, Flow Cyt, IHC-P

• Positive control:
• Gastrointestinal stromal tumor (GIST) and testicular germ cell tumor tissues. Melanocytes in the basal layer of the epidermis and mast cells in the dermis of normal skin.

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

• Clonality:
• Monoclonal

• Form:
• Liquid