Mouse Anti-TIMP2 Monoclonal Antibody Online Inquiry

• Cat#:
• FPA-20516M

• Product Name:
• Mouse Anti-TIMP2 Monoclonal Antibody

• Host Species:
• Mouse

• Immunogen:
• Recombinant full length protein (proprietary-tag) corresponding to Human TIMP2 AA 27-220. Mature form of TIMP2 (amino acids 27-220). The initial signal peptide has been removed. Sequence: CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQI KMFKGPEKDIEFIYTA

• Species Reactivity:
• Human

• Clone#:
• 4A11

• Isotype:
• IgG2a

• Application:
• WB, IHC-P, ICC/IF

• Positive control:
• Human prostate tissue; HeLa cells

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

• Clonality:
• Monoclonal

• Form:
• Liquid