Mouse Anti-SLC35A3 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-38657P

• Product Name:
• Mouse Anti-SLC35A3 Polyclonal Antibody

• Host Species:
• Mouse

• Immunogen:
• Recombinant fragment (GST-tag) corresponding to Human SLC35A3 aa 61-113 (internal sequence). NP_036375.1. Sequence: DSKCSLRALNRVLHDEILNKPMETLKLAIPSGIYTLQNNLLYVALSNLDA ATY

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat, Cow, Dog

• Isotype:
• IgG

• Application:
• WB

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid