• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Mouse Anti-Signal sequence receptor delta Monoclonal Antibody Online Inquiry

  • Cat#:
  • FPA-19043M
  • Product Name:
  • Mouse Anti-Signal sequence receptor delta Monoclonal Antibody
  • Host Species:
  • Mouse
  • Immunogen:
  • Recombinant fragment corresponding to Human Signal sequence receptor delta AA 24-144. Topological domain (lumenal) purified from E. coli. Sequence: EACLEPQITPSYYTTSDAVISTETVFIVEISLTCKNRVQNMALYADVGGK QFPVTRGQDVGRYQVSWSLDHKSAHAGTYEVRFFDEESYSLLRKAQRNNE DISII
  • Species Reactivity:
  • Human Predicted to work with: Mouse, Rat, Cow, Orangutan
  • Clone#:
  • ZS15F4
  • Isotype:
  • IgG1
  • Application:
  • WB
  • Positive control:
  • MCF7 lysate.
  • Storage Buffer:
  • pH: 7.4 Preservative: 0.02% Sodium azide Constituents: 10% Glycerol, 89% PBS
  • Storage Procedures:
  • Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Clonality:
  • Monoclonal
  • Form:
  • Liquid
  • Pre product:Rat Anti-SIGN Related 1 Monoclonal Antibody-FPA-19042M
  • Online Inquiry

    refresh