Cat#:FPA-19043M;Product Name:Mouse Anti-Signal sequence receptor delta Monoclonal Antibody;Host Species:Mouse ;Immunogen:Recombinant fragment corresponding to Human Signal sequence receptor delta AA 24-144. Topological domain (lumenal) purified from E. coli. Sequence: EACLEPQITPSYYTTSDAVISTETVFIVEISLTCKNRVQNMALYADVGGK QFPVTRGQDVGRYQVSWSLDHKSAHAGTYEVRFFDEESYSLLRKAQRNNE DISII;Species Reactivity:Human Predicted to work with: Mouse, Rat, Cow, Orangutan;Clone#:ZS15F4;Isotype:IgG1;Application:WB;Positive control:MCF7 lysate.;Storage Buffer:pH: 7.4 Preservative: 0.02% Sodium azide Constituents: 10% Glycerol, 89% PBS;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.;
Recombinant fragment corresponding to Human Signal sequence receptor delta AA 24-144. Topological domain (lumenal) purified from E. coli. Sequence: EACLEPQITPSYYTTSDAVISTETVFIVEISLTCKNRVQNMALYADVGGK QFPVTRGQDVGRYQVSWSLDHKSAHAGTYEVRFFDEESYSLLRKAQRNNE DISII
Species Reactivity:
Human Predicted to work with: Mouse, Rat, Cow, Orangutan