Mouse Anti-Serine/threonine-protein kinase pknB Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-37722P

• Product Name:
• Mouse Anti-Serine/threonine-protein kinase pknB Polyclonal Antibody

• Host Species:
• Mouse

• Immunogen:
• Recombinant fragment corresponding to Serine/threonine-protein kinase pknB aa 187-278. Recombinant protein fragment of Mycobacterium tuberculosis expressed in E.coli. Sequence: QARGDSVDARSDVYSLGCVLYEVLTGEPPFTGDSPVSVAYQHVREDPIPP SARHEGLSADLDAVVLKALAKNPENRY

• Species Reactivity:
• Recombinant fragment

• Isotype:
• IgG1

• Application:
• WB

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid