Mouse Anti-S100A10 Monoclonal Antibody Online Inquiry

• Cat#:
• FPA-18587M

• Product Name:
• Mouse Anti-S100A10 Monoclonal Antibody

• Host Species:
• Mouse

• Immunogen:
• Recombinant full length protein corresponding to amino acids 1-98 ( MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPL AVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK ), of Human S100A10 (AAH15973) with proprietary tag.

• Species Reactivity:
• Rat, Human Predicted to work with: Mouse, Rabbit, Chicken, Cow, Pig, Rhesus monkey

• Clone#:
• 27EF527

• Isotype:
• IgG2a

• Application:
• Flow Cyt, WB, ELISA

• Positive control:
• HeLa cell lysate

• Storage Buffer:
• Preservative: None Constituents: 1X PBS, pH 7.2

• Storage Procedures:
• Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

• Clonality:
• Monoclonal

• Form:
• Liquid