Mouse Anti-RPL37A Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-36511P

• Product Name:
• Mouse Anti-RPL37A Polyclonal Antibody

• Host Species:
• Mouse

• Immunogen:
• Recombinant fragment (GST-tag) corresponding to Human RPL37A aa 2-50 (N terminal). (NP_000989). Sequence: AKRTKKVGIVGKYGTRYGASLRKMVKKIEISQHAKYTCSFCGKTKMKRR

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat, Chicken, Cow, Xenopus laevis, Drosophila melanogaster, Orangutan

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Constituent: 50% Glycerol

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid