• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Mouse Anti-RAB11B Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-34650P
  • Product Name:
  • Mouse Anti-RAB11B Polyclonal Antibody
  • Host Species:
  • Mouse
  • Immunogen:
  • Full length protein corresponding to Human RAB11B aa 1-218. Full length protein, corresponding to aa 1-218 of Human Rab11b (NP_004209). Sequence: MGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFAT RSIQVDGKTIKAQIWDTAGQERYRRITSAYYRGAVGALLVYDIAKHLTYE NVERWLK
  • Species Reactivity:
  • Human Predicted to work with: Mouse, Rat, Cow
  • Isotype:
  • IgG
  • Application:
  • WB
  • Storage Buffer:
  • pH: 7.20 Constituent: 99% PBS
  • Storage Procedures:
  • Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.
  • Clonality:
  • Polyclonal
  • Form:
  • Liquid
  • Pre product:Goat Anti-Rab11A Polyclonal Antibody-FPA-34649P
  • Online Inquiry

    refresh