Mouse Anti-RAB11B Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-34650P

• Product Name:
• Mouse Anti-RAB11B Polyclonal Antibody

• Host Species:
• Mouse

• Immunogen:
• Full length protein corresponding to Human RAB11B aa 1-218. Full length protein, corresponding to aa 1-218 of Human Rab11b (NP_004209). Sequence: MGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFAT RSIQVDGKTIKAQIWDTAGQERYRRITSAYYRGAVGALLVYDIAKHLTYE NVERWLK

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat, Cow

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• pH: 7.20 Constituent: 99% PBS

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.

• Clonality:
• Polyclonal

• Form:
• Liquid