• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Mouse Anti-Protein C inhibitor Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-33909P
  • Product Name:
  • Mouse Anti-Protein C inhibitor Polyclonal Antibody
  • Host Species:
  • Mouse
  • Immunogen:
  • Full length protein corresponding to Human Protein C inhibitor aa 17-406. Mature form including the propeptide (AAH08915). Sequence: ASLHRHHPREMKKRVEDLHVGATVAPSSRRDFTFDLYRALASAAPSQNIF FSPVSISMSLAMLSLGAGSSTKMQILEGLGLNLQKSSEKELHRGFQQLLQ ELNQPRDGFQLSLGNALFTD
  • Species Reactivity:
  • Human
  • Isotype:
  • IgG
  • Application:
  • WB, IHC-P
  • Storage Buffer:
  • pH: 7.2 Constituent: 100% PBS
  • Storage Procedures:
  • Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.
  • Clonality:
  • Polyclonal
  • Form:
  • Liquid
  • Pre product:Rabbit Anti-Protein C inhibitor Polyclonal Antibody-FPA-33908P
  • Online Inquiry

    refresh