Cat#:FPA-33511P;Product Name:Mouse Anti-Presenilin 1 Polyclonal Antibody;Host Species:Mouse ;Immunogen:Synthetic peptide within Human Presenilin 1 aa 250-300 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary. Sequence: LAVISVYDLVAVLCPKGPLRMLVETAQERNETLFPALIYSSTMVWLVNMA E ;Species Reactivity:Human Predicted to work with: Rat, Rabbit;Isotype:IgG;Application:WB;Storage Buffer:Preservative: 0.09% Sodium azide Constituents: 50% Glycerol, 1% BSA;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;
Synthetic peptide within Human Presenilin 1 aa 250-300 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary. Sequence: LAVISVYDLVAVLCPKGPLRMLVETAQERNETLFPALIYSSTMVWLVNMA E