• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Mouse Anti-PRE7 Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-33473P
  • Product Name:
  • Mouse Anti-PRE7 Polyclonal Antibody
  • Host Species:
  • Mouse
  • Immunogen:
  • Vector coding for a partial recombinant fusion protein, corresponding to aa 11-110 of Saccharomyces cerevisiae PRE7. Target sequence used to make the antibody:- YSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPGTNGKVKK PLKYLSVEEVIKLVRDSFTSATERHIQVGDGL EILIVTKDGVRK
  • Species Reactivity:
  • Saccharomyces cerevisiae
  • Isotype:
  • IgG
  • Application:
  • WB
  • Storage Buffer:
  • Preservative: None Constituents: 50% Glycerol, Whole serum
  • Storage Procedures:
  • Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Clonality:
  • Polyclonal
  • Form:
  • Liquid
  • Pre product:Mouse Anti-Pre4 Polyclonal Antibody-FPA-33472P
  • Online Inquiry

    refresh