Mouse Anti-PRE7 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-33473P

• Product Name:
• Mouse Anti-PRE7 Polyclonal Antibody

• Host Species:
• Mouse

• Immunogen:
• Vector coding for a partial recombinant fusion protein, corresponding to aa 11-110 of Saccharomyces cerevisiae PRE7. Target sequence used to make the antibody:- YSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPGTNGKVKK PLKYLSVEEVIKLVRDSFTSATERHIQVGDGL EILIVTKDGVRK

• Species Reactivity:
• Saccharomyces cerevisiae

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Preservative: None Constituents: 50% Glycerol, Whole serum

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid