Cat#:FPA-16932M;Product Name:Mouse Anti-PKC beta 2 Monoclonal Antibody;Host Species:Mouse ;Immunogen:Recombinant fragment corresponding to Human PKC beta 2 AA 607-673. Sequence: KLERKEIQPPYKPKACGRNAENFDRFFTRHPPVLTPPDQEVIRNIDQSEF EGFSFVNSEFLKPEVKS ;Species Reactivity:Human Predicted to work with: Mouse, Rat, Rabbit, Cow, Xenopus laevis, Xenopus tropicalis;Clone#:LL1958-2K42;Isotype:IgG1;Application:WB;Positive control:Human lung cancer cell lysate;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.;