Mouse Anti-PIGM Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-32268P

• Product Name:
• Mouse Anti-PIGM Polyclonal Antibody

• Host Species:
• Mouse

• Immunogen:
• Recombinant fragment (GST-tag) corresponding to Human PIGM aa 35-96. (NP_660150). Sequence: YGVFQDRTLHVRYTDIDYQVFTDAARFVTEGRSPYLRATYRYTPLLGWLL TPNIYLSELFGK

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat, Cow, Cynomolgus monkey, Orangutan

• Isotype:
• IgG

• Application:
• WB

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid