Mouse Anti-PC3 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-31072P

• Product Name:
• Mouse Anti-PC3 Polyclonal Antibody

• Host Species:
• Mouse

• Immunogen:
• Vector coding for a partial recombinant fusion protein, corresponding to aa 510-609 of PC3 from Medaka. Target sequence used to make the antibody:- DLTCVRRRSEKRLRKTIRTLRKSINREQFHLHFAGSEY ELAKKLVRPADTPDHCGTGQILLDKKCVKCSVGTYYDGEQGRCFLCPPGT YQDEEGQVSCDV

• Species Reactivity:
• Reacts with Medaka fish (Oryzias latipes).

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Preservative: None Constituents: 50% Glycerol, Whole serum.

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid