• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Mouse Anti-PC3 Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-31072P
  • Product Name:
  • Mouse Anti-PC3 Polyclonal Antibody
  • Host Species:
  • Mouse
  • Immunogen:
  • Vector coding for a partial recombinant fusion protein, corresponding to aa 510-609 of PC3 from Medaka. Target sequence used to make the antibody:- DLTCVRRRSEKRLRKTIRTLRKSINREQFHLHFAGSEY ELAKKLVRPADTPDHCGTGQILLDKKCVKCSVGTYYDGEQGRCFLCPPGT YQDEEGQVSCDV
  • Species Reactivity:
  • Reacts with Medaka fish (Oryzias latipes).
  • Isotype:
  • IgG
  • Application:
  • WB
  • Storage Buffer:
  • Preservative: None Constituents: 50% Glycerol, Whole serum.
  • Storage Procedures:
  • Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Clonality:
  • Polyclonal
  • Form:
  • Liquid
  • Pre product:Rabbit Anti-PC1/3 Polyclonal Antibody-FPA-31071P
  • Online Inquiry

    refresh