• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Mouse Anti-Odorant Receptor 42a Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-29511P
  • Product Name:
  • Mouse Anti-Odorant Receptor 42a Polyclonal Antibody
  • Host Species:
  • Mouse
  • Immunogen:
  • Fusion protein: AHMSIFAERLRRLGTYPYESQEQKYERLVQCIQDHKVILR , corresponding to aa 220/259 of Fruit fly (Drosophila melanogaster) Odorant Receptor 42a
  • Species Reactivity:
  • Drosophila melanogaster
  • Isotype:
  • IgG
  • Application:
  • WB
  • Storage Buffer:
  • Constituents: 50% Glycerol
  • Storage Procedures:
  • Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.
  • Clonality:
  • Polyclonal
  • Form:
  • Liquid
  • Pre product:Rabbit Anti-ODF4 Polyclonal Antibody-FPA-29510P
  • Online Inquiry

    refresh