Cat#:FPA-28414P;Product Name:Mouse Anti-Nicotinic Acetylcholine Receptor alpha 5 Polyclonal Antibody;Host Species:Mouse ;Immunogen:Recombinant fragment (GST-tag) corresponding to Human Nicotinic Acetylcholine Receptor alpha 5 aa 38-131. NP_000736 Sequence: SEPSSIAKHEDSLLKDLFQDYERWVRPVEHLNDKIKIKFGLAISQLVDVD EKNQLMTTNVWLKQEWIDVKLRWNPDDYGGIKVIRVPSDSVWTP ;Species Reactivity:Human Predicted to work with: Mouse, Rat, Cow;Isotype:IgG;Application:WB;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;
Recombinant fragment (GST-tag) corresponding to Human Nicotinic Acetylcholine Receptor alpha 5 aa 38-131. NP_000736 Sequence: SEPSSIAKHEDSLLKDLFQDYERWVRPVEHLNDKIKIKFGLAISQLVDVD EKNQLMTTNVWLKQEWIDVKLRWNPDDYGGIKVIRVPSDSVWTP
Species Reactivity:
Human Predicted to work with: Mouse, Rat, Cow
Isotype:
IgG
Application:
WB
Storage Procedures:
Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.