Mouse Anti-MUC2 Monoclonal Antibody Online Inquiry

• Cat#:
• FPA-14631M

• Product Name:
• Mouse Anti-MUC2 Monoclonal Antibody

• Host Species:
• Mouse

• Immunogen:
• Synthetic peptide corresponding to Human MUC2 AA 1896-1922 conjugated to keyhole limpet haemocyanin. Sequence: KYPTTTPISTTTTTMVTPTPTPTGTQTPTTT

• Species Reactivity:
• Human

• Clone#:
• ROL42

• Isotype:
• IgG1

• Application:
• IHC-P, ICC/IF, Flow Cyt

• Positive control:
• Human colon carcinoma tissue;LS174T cells.

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

• Clonality:
• Monoclonal

• Form:
• Liquid