Cat#:FPA-13843M;Product Name:Mouse Anti-MCU Monoclonal Antibody;Host Species:Mouse ;Immunogen:Recombinant fragment corresponding to Human MCU AA 285-349. Sequence: TRQEYVYPEARDRQYLLFFHKGAKKSRFDLEKYNQLKDAIAQAEMDLKRL RDPLQVHLPLRQIGE ;Species Reactivity:Human Predicted to work with: Mouse, Rat;Clone#:BK2465;Isotype:IgG1;Application:ICC/IF, WB;Positive control:A549 cell extracts; A549 cells.;Storage Buffer:pH: 7.20 Preservative: 0.02% Sodium azide Constituents: 59% PBS, 40% Glycerol;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.;