Cat#:FPA-12877M;Product Name:Mouse Anti-Ku70 Monoclonal Antibody;Formulation:Liquid;Host Species:Mouse ;Immunogen:Recombinant fragment corresponding to Human Ku70 AA 6-214. Expressed in E. Coli. Sequence: SYYKTEGDEEAEEEQEENLEASGDYKYSGRDSLIFLVDASKAMFESQSED ELTPFDMSIQCIQSVYISKIISSDRDLLAVVFYGTEKDKNSVNFKNIYVL QELDNPGAKRILELDQFKGQQGQKRFQDMMGHGSDYSLSEVLWVCANLFS DVQFKMSHKRI;Species Reactivity:Human Predicted to work with: Mouse;Clone#:1E6E4;Isotype:IgG1;Application:WB, IHC-P, Flow Cyt;Positive control:Human Ku70 (aa: 6-214) recombinant protein; Ku70 (aa: 6-214)-hIgGFc transfected HEK293 cell lysate; HeLa, PC-2, A549, A431, HepG2 and K562 cell lysates; A431 cells; Human endometrial cancer and cervical cancer tissues;Storage Buffer:Preservative: 0.05% Sodium azide Constituent: 99% PBS;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.;