Cat#:FPA-12843M;Product Name:Mouse Anti-KMT6 / EZH2 Monoclonal Antibody;Formulation:Liquid;Host Species:Mouse ;Immunogen:Recombinant fragment corresponding to Human KMT6/ EZH2 AA 1-194 (N terminal). Expressed in E. Coli. Sequence: MGQTGKKSEKGPVCWRKRVKSEYMRLRQLKRFRRADEVKSMFSSNRQKIL ERTEILNQEWKQRRIQPVHILTSVSSLRGTRECSVTSDLDFPTQVIPLKT LNAVASVPIMYSWSPLQQNFMVEDETVLHNIPYMGDEVLDQDG;Species Reactivity:Human Predicted to work with: Mouse, Xenopus laevis, Zebrafish, Cynomolgus monkey, Xenopus tropicalis;Clone#:5F3E3;Isotype:IgG1;Application:WB, Flow Cyt, IHC-P;Positive control:Human KMT6 / EZH2 (amino acids 1-194) recombinant protein. Lysate from HEK293 cells transfected with KMT6 / EZH2 (amino acids 1-194). Human lung cancer and colon cancer tissues. HeLa cells.;Storage Buffer:Preservative: 0.05% Sodium azide Constituent: 99% PBS;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.;