Mouse Anti-KMT4 / Dot1L Monoclonal Antibody Online Inquiry

• Cat#:
• FPA-12838M

• Product Name:
• Mouse Anti-KMT4 / Dot1L Monoclonal Antibody

• Formulation:
• Liquid

• Host Species:
• Mouse

• Immunogen:
• Recombinant fragment corresponding to Human KMT4/ Dot1L AA 1-420. Folded protein domain corresponding to the HMT region of Human KMT4/ Dot1L. Sequence: MGEKLELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPD LKLAMENYVLIDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNT R

• Species Reactivity:
• Human

• Clone#:
• 27EF323

• Isotype:
• IgG1

• Application:
• IP, MS

• Positive control:
• HEK293 cells.

• Storage Buffer:
• Preservative: 0.09% Sodium azide Constituent: 99% PBS

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.