• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Mouse Anti-KMT2B / MLL4 Monoclonal Antibody Online Inquiry

  • Cat#:
  • FPA-12832M
  • Product Name:
  • Mouse Anti-KMT2B / MLL4 Monoclonal Antibody
  • Formulation:
  • Liquid
  • Host Species:
  • Mouse
  • Immunogen:
  • Recombinant fragment (proprietary-tag) corresponding to Human KMT2B/ MLL4 AA 813-904. Entrez gene ID: 9757 Sequence: KVAASMPLSPGGQMEEVAGAVKQISDRGPVRSEDESVEAKRERPSGPESP VQGPRIKHVCRHAAVALGQARAMVPEDVPRLSALPLRDRQDL
  • Species Reactivity:
  • Human
  • Clone#:
  • 3B19
  • Isotype:
  • IgG1
  • Application:
  • WB, Flow Cyt
  • Storage Buffer:
  • Preservative: None PBS, pH 7.2
  • Storage Procedures:
  • Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Pre product:Mouse Anti-KMT2A / MLL Monoclonal Antibody-Advanced Biomart
  • Online Inquiry

    refresh